Preview is a low-resolution watermarked version. Licensed download is a clean HD 1080p master. Download free watermarked preview to test in your edit

OCTOBER 6, 2019. DENVER, COLORADO-Woman And A Little Girl Playing A Game

30s HD 1080p 29.97fps Denver, United States 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A vibrant 2019 vintage film clip from Denver, Colorado, capturing a woman and a young girl immersed in an arcade game at a bustling indoor entertainment center. The scene unfolds with playful energy as the girl, with short blonde hair, focuses intently on the game, guided by her mother or caregiver. The lively atmosphere reflects a family-friendly zone filled with interactive art, bar games, and carnival-style attractions. This authentic slice of modern Americana showcases a moment of connection, skill, and fun, ideal for content exploring family life, parenting, or contemporary leisure activities.

Clip Intelligence

Production use
Useful for documentary, brand, social, or family travel edits needing a real 2019 Denver indoor arcade moment with an adult and child playing together.
Edit role
Works as a 30-second observational cutaway or sequence beat between broader family entertainment scenes, with repeated focus on the game cabinet and player interaction.
Visual details
A blonde woman and young blonde girl stand at a bright carnival-style arcade game with blue panels, red trim, illustrated targets, and dim indoor entertainment lighting behind them.

Tags

blonde hairshort hairindoorsinteractive artplaying gamesinsideactivityarcadefuncenterzoneareabusytourist attractioncarnivalwinningplayinglearninggamergirl

Shot slate

Resolution
1920 × 1080
Frame rate
29.97 fps
Duration
30s
Codec
H.264 MP4
File size
49 MB
Location
Denver, United States
Year filmed
2019
Published
Oct 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At 0:00 in Denver, a blonde woman and young girl stand beside a tall illustrated arcade game with blue play panels and red trim.
The opening frame sets up the adult and child playing together at the arcade cabinet. (0:00)
At 0:01 in Denver, the girl reaches toward the lower game controls while the woman stands close beside the colorful cabinet.
This frame shows the child engaging with the game while the adult monitors the play. (0:01)
Woman and child face a carnival-style arcade game.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant download of the HD 1080p master with a license PDF, direct from filmmaker Phil Maher.