Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

Beautiful Wife Swimming in Los Cabos

13s 4K UHD Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The underwater scene showcases vibrant coral reefs and tropical marine life, with sunlight filtering through the warm, clean sea. The footage highlights the natural beauty of the Pacific coastline, featuring lush green sea life and rocky formations.

Clip Intelligence

Production use
Suited for travel documentary segments, eco-tourism brand films, ocean or diving social content, and destination travel projects focused on Mexico's Pacific coast.
Edit role
At 13 seconds, this functions as an underwater cutaway or texture insert to break up surface-level or aerial footage within a travel, nature, or diving sequence.

Tags

waterunderwaternatureseaoceanfishbluewildlifetropicaldivinganimalreefmarineswimmingenvironmentcoraltravelscubalandscapewild

Shot slate

Resolution
4K UHD
Duration
13s
Codec
H.264 MP4
Location
Los Cabos, Mexico
Year filmed
2019
Published
Oct 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Rocky seafloor blanketed in green algae in the coastal waters of Los Cabos, Mexico, viewed from underwater with clear teal water and diffused surface light above, no people visible
The clip opens on the algae-covered rocky seafloor of the Los Cabos coast, with clear teal water and ambient sunlight filtering from above. (0:00)
Rocky seafloor covered in green algae in shallow coastal water near Los Cabos, Mexico, with teal water above and light filtering from the surface, no people visible
The camera holds along the algae-covered rocky bottom as teal water and diffused sunlight fill the upper frame. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.