Low-resolution preview (256x144) for evaluation. The licensed download is the clean HD 1080p master at the stated resolution.

Download the free low-res preview to test in your edit

Beautiful Wife Swimming in Los Cabos (2019)

13s HD 1080p 29.97fps Wildlife Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The underwater scene showcases vibrant coral reefs and tropical marine life, with sunlight filtering through the warm, clean sea. The footage highlights the natural beauty of the Pacific coastline, featuring lush green sea life and rocky formations.

Clip Intelligence

Production use
Suited for travel documentary segments, eco-tourism brand films, ocean or diving social content, and destination travel projects focused on Mexico's Pacific coast.
Edit role
At 13 seconds, this functions as an underwater cutaway or texture insert to break up surface-level or aerial footage within a travel, nature, or diving sequence.
Visual details
Frames show a rocky seafloor covered in green algae viewed through clear teal water, with diffused sunlight filtering from the surface, and a person or partial body visible in several frames around 0:03 to 0:05.
Shot mechanics
The footage is captured from an underwater perspective close to the seafloor, looking along the bottom with a wide-angle composition consistent with a handheld action camera, not aerial drone capture.

Tags

waterunderwaternatureseaoceanfishbluewildlifetropicaldivinganimalreefmarineswimmingenvironmentcoraltravelscubalandscapewild

Shot slate

Resolution
1920 × 1080
Frame rate
29.97 fps
Duration
13s
Codec
H.264 MP4
File size
34 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Oct 2019

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Rocky seafloor blanketed in green algae in the coastal waters of Los Cabos, Mexico, viewed from underwater with clear teal water and diffused surface light above, no people visible
The clip opens on the algae-covered rocky seafloor of the Los Cabos coast, with clear teal water and ambient sunlight filtering from above. (0:00)
Rocky seafloor covered in green algae in shallow coastal water near Los Cabos, Mexico, with teal water above and light filtering from the surface, no people visible
The camera holds along the algae-covered rocky bottom as teal water and diffused sunlight fill the upper frame. (0:01)
Rocky coastal seafloor blanketed in green algae near Los Cabos, Mexico, with clear teal water and brighter surface light visible toward the upper frame, no people visible
Clear teal water and surface light remain prominent above the algae-draped seafloor as the underwater perspective continues. (0:02)
White shape at frame left, possibly a person's arm or body in light swimwear, rocky algae-covered seafloor in background, teal water

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant download of the HD 1080p master with a license PDF, direct from filmmaker Phil Maher.