Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HUNTINGTON BEACH CALIFORNIA-2020: A Family Decides to Walk on the Shore

5s 4K UHD Huntington Beach, California, United States 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Parents and a young child walk barefoot on the sand, enjoying a sunny day by the ocean. The natural light and casual movement evoke a sense of warmth and connection. This authentic slice of life showcases a simple, joyful moment of togetherness at the beach. Ideal for nostalgic content, family-themed projects, or emotional storytelling.

Clip Intelligence

Production use
This clip fits documentary, travel, family, and brand edits that need a real beach family moment at Huntington Beach with visible surf and casual shoreline movement.
Edit role
Use it as a short cutaway, transition beat, or family-life insert between wider surfing and ocean shots in a beach sequence.

Tags

oceanmossyfamilywalkingchilddecidewalkshorepeoplehuntington BEACH california2020cuteintroductionbuyamateurlovecameracinematographykind

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Huntington Beach, California, United States
Year filmed
2020
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A woman and young child stand near shallow water at Huntington Beach, California, with breaking waves and a distant surfer in the background.
This opening frame shows the family paused at the shoreline with surf activity behind them. (0:00)
Woman and child face the surf on wet sand

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.