Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

A Family Decides to Walk on the Shore (Huntington Beach, 2020)

5s 4K UHD 29.97fps People Huntington Beach, California, United States 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Parents and a young child walk barefoot on the sand, enjoying a sunny day by the ocean. The natural light and casual movement evoke a sense of warmth and connection. This authentic slice of life showcases a simple, joyful moment of togetherness at the beach. Ideal for nostalgic content, family-themed projects, or emotional storytelling.

Clip Intelligence

Production use
This clip fits documentary, travel, family, and brand edits that need a real beach family moment at Huntington Beach with visible surf and casual shoreline movement.
Edit role
Use it as a short cutaway, transition beat, or family-life insert between wider surfing and ocean shots in a beach sequence.
Visual details
A woman and young child walk barefoot through shallow water while waves break behind them, with a surfer farther out and bright daylight reflecting off wet sand.
Shot mechanics
Ground-level shoreline composition places the people in the foreground and midground, open surf across the background, and a level ocean horizon near the top of the frame.

Tags

oceanmossyfamilywalkingchilddecidewalkshorepeoplehuntington BEACH californiacuteintroductionbuyamateurlovecameracinematographykind

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
55 MB
Location
Huntington Beach, California, United States
Year filmed
2020
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A woman and young child stand near shallow water at Huntington Beach, California, with breaking waves and a distant surfer in the background.
This opening frame shows the family paused at the shoreline with surf activity behind them. (0:00)
A woman and child face the ocean at Huntington Beach, California, while small waves roll in and a distant surfer moves across the background water.
The frame holds the pair in the foreground while the surf line fills the background. (0:01)
A woman and child walk along wet sand at Huntington Beach, California, with white surf behind them and the adult carrying a dark bag.
This moment gives buyers a side view of the beach walk with moving water close to the subjects. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.