Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HUNTINGTON BEACH CALIFORNIA-2020: Three Camping Vans Parked On The Side Of The Highway

6s 4K UHD 29.97fps Huntington Beach, California, United States 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

HUNTINGTON BEACH CALIFORNIA-2020: Three camping vans parked on the side of a coastal highway, capturing a modern road trip scene. The vans are lined up along the roadside, suggesting a group adventure or family outing. This home movie footage offers a nostalgic, candid glimpse into contemporary American road culture. The setting evokes a sense of freedom and exploration, with the Pacific coastline likely nearby. Ideal for travel, lifestyle, or Americana-themed projects.

Clip Intelligence

Production use
Fits travel edits, documentary road culture pieces, agency mood reels, brand films, and social cuts needing parked camping vans beside a Huntington Beach roadside in 2020.
Edit role
Use as a short cutaway, transition beat, or location texture between surf or coastal road-trip scenes, with the six-second runtime suited to a quick pause in a sequence.
Visual details
Three white camping vans sit behind a low wall and red railing in dim pink-gray light, with RV decals, roof units, dark windows, and no clearly visible people in the sampled frames.

Tags

roadcarsvanscampingparkinghighwaythreeparkedsidetransportationhuntington BEACH california C2020buyprofessionalartmodern4k

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
68 MB
Location
Huntington Beach, California, United States
Year filmed
2020
Published
Jan 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Three camping vans are parked beside a roadside wall in Huntington Beach, California, with muted evening color and no visible people in this first frame.
The opening frame shows the roadside RV lineup used as a quiet travel cutaway. (0:00)
The parked camping vans remain lined up behind the foreground wall in Huntington Beach, California, with RV graphics and roof equipment visible and no visible people.
This frame keeps attention on the repeated RV shapes, windows, and rooftop details. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.