Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BAJA CALIFORNIA SUR-2019: A Single Fish Swimming In The Deep Blue Sea

5s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Shot on a DJI device, the clip captures the tranquil beauty of marine life in its natural habitat. The calm, slow-motion movement of the fish creates a meditative, cinematic moment ideal for nature documentaries, ambient background scenes, or reflective storytelling. Perfect for editorial use, travel content, or environmental themes.

Clip Intelligence

Production use
Aerial ocean texture from Baja California Sur for travel edits, wildlife documentaries, agency mood reels, brand films, or social cuts needing open blue-green water with a small marine subject.
Edit role
Use this short clip as a quiet cutaway, transition, or reflective beat between broader coastline, whale, or ocean-view shots in a Baja California Sur sequence.

Tags

animalrelaxbluebeautifulserenesinglefishswimmingdeepsealakeanimalswildlifeeast cape baja california SUR DJI needlfisheastb-rollstunningintroart

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Top-down view of blue-green water in Baja California Sur with fine surface ripples, a few bright glints, faint floating lines, and no visible people.
The opening frame establishes a minimal overhead view of rippled ocean water for a quiet marine insert. (0:00)
Blue-green sea in Baja California Sur fills the frame from above, with subtle wave texture, small white reflections, faint linear debris or fish shapes, and no visible people.
This frame keeps the open-water texture centered, useful as a clean transition or atmospheric beat. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.