Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BCS MEXICO-2019: Aerial View of Gray Shape Swimming Beneath Water

5s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial footage from East Cape BCS, Mexico, in 2019 captures a gray shape gliding beneath the surface of a calm body of water. The natural lighting and smooth motion evoke a sense of wonder and tranquility, ideal for nature documentaries, wildlife presentations, or scenic B-roll.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, or social cut needing overhead marine wildlife in Baja California Sur without people, boats, resorts, or shoreline in frame.
Edit role
Works as a short cutaway or texture beat between wider ocean views and closer wildlife moments, giving editors a five-second overhead glimpse of a gray underwater shape moving through shallow water.
Visual details
The frames show green-blue water from above with a soft gray marine shape beneath the surface, faint sand or water texture, muted natural light, and no visible people.

Tags

animalsaquaticmarinebiologystudyviewhighbodywatergrayshapeswimsraywildlifeeast cape BCS mexico DJIeast4kcinematicb-rollmodern

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Top-down aerial view in Baja California Sur, Mexico, showing green-blue water and a dark gray shape beneath the surface near the left side, with no visible people.
This opening frame gives editors an overhead marine texture with a faint underwater subject entering the sequence. (0:00)
Aerial frame from Baja California Sur, Mexico, with a soft gray underwater shape set against open green-blue water and no visible people.
The frame keeps the subject subtle, useful as a quiet cutaway in a marine wildlife edit. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.