Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BCS MEXICO-2019: Aerial Footage Of Needle Fish In East Cape

6s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial footage from East Cape BCS, Mexico in 2019 captures a needlefish gliding over the ocean surface near the coastline. The natural wildlife moment highlights the marine ecosystem of the Baja California Sur region. This authentic, unscripted footage offers a rare glimpse of coastal wildlife in motion, ideal for nature documentaries, travel content, or environmental storytelling.

Clip Intelligence

Production use
Use this 4K aerial ocean surface clip for a Baja California Sur travel edit, marine wildlife documentary, agency mood reel, brand film, or social cut needing open turquoise water with a subtle wildlife context.
Edit role
The short six-second run works as a quiet cutaway, insert, or texture beat between stronger coastline, whale, or marine wildlife shots rather than as a broad establishing opener.
Visual details
The frames show turquoise ocean water from above with small ripples, scattered sun glints, and no visible people, boats, shoreline, logos, or built structures.

Tags

oceanfishneedlefisheast capewavesamazingaerialfootageneedleeastcapedayanimalswildlifeeast cape BCS mexico DJI needlefish zoominbuybusinessabstractstock video

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of turquoise ocean water in Baja California Sur, Mexico, with fine ripples and no visible people.
The opening frame provides a clean aerial water texture for a Baja marine sequence. (0:00)
Blue-green ocean surface fills the frame in Baja California Sur, Mexico, with faint diagonal ripple patterns and no visible people.
This moment keeps the frame abstract, useful as a quiet cutaway or background plate. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.