Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BCS MEXICO-2019: Small Shark Swimming Freely In The Sea

5s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The natural movement of the marine life highlights the beauty of the ocean ecosystem. Ideal for nature documentaries, environmental content, or cinematic b-roll with a raw, authentic feel.

Clip Intelligence

Production use
Aerial wildlife b-roll for nature documentaries, conservation explainers, travel edits, brand films, or social cuts needing a small shark visible in clear Baja California Sur water.
Edit role
Use this short clip as a wildlife insert, transition beat, or quiet cutaway between wider ocean views and marine-life details in a Baja California Sur sequence.
Visual details
A dark shark swims just below turquoise sea surface, with ripples, small white flashes of foam, sun glints on the water, and no visible people, boats, shore, or buildings.

Tags

fishwaterbluenaturebeautysmallsharkswimmingfreelyseaeast cape BCS mexico DJIeastbuyabstractartbusiness4kstunningprofessional

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of a dark shark just below the turquoise sea surface in Baja California Sur, Mexico, with small sun glints on the water and no visible people.
The opening frame places the shark beneath clear water with open sea filling the composition. (0:00)
A dark shark remains near the center of an overhead Baja California Sur water view, with rippled green-blue surface texture and no visible people.
This frame shows the shark continuing through a clean all-water background for a usable wildlife insert. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.