Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Closeup Open Water Outside Blue Turquoise Beach (Baja California Sur, 2019)

5s 4K UHD 29.97fps Beach Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Close-up footage of open turquoise water at a beach in East Cape BCS, Mexico, captured in 2019. The vibrant blue and green hues of the ocean shimmer under natural light, with gentle waves lapping against the shore. Ideal for travel, nature, or lifestyle content.

Clip Intelligence

Production use
Useful for travel edits, documentary geography segments, agency mood reels, brand films, and social cuts needing aerial turquoise water and an empty Baja California Sur beach.
Edit role
Works as a short opener, transition, or cutaway that gives editors six seconds of coastline texture before moving into a beach, ocean, conservation, or travel sequence.
Visual details
The frames show blue-green open water in the foreground, a pale sandy beach along the right side, low dunes and green hills beyond, natural daylight, a small distant sailboat in early frames, and no visible people.
Shot mechanics
The DJI drone hint is supported by the elevated offshore angle, with water filling the foreground, the shoreline running diagonally through the midground, and dunes and hills set behind the beach.

Tags

wavesmagicaldeepgreeneryislandcloseupopenwaterblueturquoisebeachcurrentsearchingenvironmentnatureeast cape BCS mexico DJIeastamateurb-roll

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
70 MB
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over turquoise water toward a long Baja California Sur beach, with pale sand, dunes, green hills, a distant sailboat, and no visible people.
The opening frame sets the coastline with open water, beach, dunes, and hills in one elevated view. (0:00)
High offshore view in Baja California Sur with blue-green water filling the foreground, a diagonal sandy shoreline, low dunes, green hills, a small distant sailboat, and no visible people.
This second shows the shoreline angle more clearly as the water color shifts from deep blue to green near shore. (0:01)
Aerial Baja California Sur coastline with turquoise ocean in front, a pale beach along the right, dunes behind the sand, distant hills, a small sailboat offshore, and no visible people.
The frame keeps the beach and offshore water balanced for an editor needing a clean coastal geography cutaway. (0:02)
Aerial frame over open blue-green water in Baja California Sur, with the sandy beach and dune line crossing the upper right, a faint distant sailboat, and no visible people.
This moment favors the ocean surface while still holding enough shoreline for location context. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.