Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BCS MEXICO-2019: Closeup Open Water Outside Blue Turquoise Beach

5s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Close-up footage of open turquoise water at a beach in East Cape BCS, Mexico, captured in 2019. The vibrant blue and green hues of the ocean shimmer under natural light, with gentle waves lapping against the shore. Ideal for travel, nature, or lifestyle content.

Clip Intelligence

Production use
Useful for travel edits, documentary geography segments, agency mood reels, brand films, and social cuts needing aerial turquoise water and an empty Baja California Sur beach.
Edit role
Works as a short opener, transition, or cutaway that gives editors six seconds of coastline texture before moving into a beach, ocean, conservation, or travel sequence.
Visual details
The frames show blue-green open water in the foreground, a pale sandy beach along the right side, low dunes and green hills beyond, natural daylight, a small distant sailboat in early frames, and no visible people.

Tags

wavesmagicaldeepgreeneryislandcloseupopenwaterblueturquoisebeachcurrentsearchingenvironmentnatureeast cape BCS mexico DJIeastamateurb-roll

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over turquoise water toward a long Baja California Sur beach, with pale sand, dunes, green hills, a distant sailboat, and no visible people.
The opening frame sets the coastline with open water, beach, dunes, and hills in one elevated view. (0:00)
High offshore view in Baja California Sur with blue-green water filling the foreground, a diagonal sandy shoreline, low dunes, green hills, a small distant sailboat, and no visible people.
This second shows the shoreline angle more clearly as the water color shifts from deep blue to green near shore. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.