Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CABO SAN LUCAS MEXICO-2020: Green Lizard On A Rock

5s 4K UHD 29.97fps Cabo San Lucas, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A green lizard perches on a sunlit rock in this 2020 home movie clip from Cabo San Lucas, Mexico. The footage captures a quiet moment in nature with natural lighting and a calm, observational tone. The vibrant green of the lizard contrasts with the earthy tones of the rock, offering a peaceful glimpse into local wildlife. This authentic, unscripted moment reflects the beauty of everyday nature in a tropical coastal setting. Ideal for environmental content, nature documentaries, or nostalgic travel montages.

Clip Intelligence

Production use
A wildlife or travel editor can use this Cabo San Lucas 2020 clip as a close nature detail in a documentary, agency mood reel, brand film, or social cut about local outdoor texture.
Edit role
The short runtime works best as a cutaway, insert, or quiet transition beat between wider ocean, beach, or rock formation shots from the same travel sequence.
Visual details
A bright green lizard stretches across sunlit rocks and woody succulent branches with small round leaves, high-contrast daylight, pale stone shadows, and no visible people.

Tags

animalswildlifegreenpeaceenvironmentlizardrockcabo SAN lucas mexico C2020cinematichome moviekindinspirationprettyintroductionamateur4kbuybusiness

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
65 MB
Location
Cabo San Lucas, Mexico
Year filmed
2020
Published
Feb 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A green lizard lies across bright rock and woody branches in Cabo San Lucas, Mexico, with round green leaves around its head and no visible people.
The opening frame gives editors a clear close view of the lizard against rock and foliage. (0:00)
The lizard remains stretched through the center of the frame in Cabo San Lucas, Mexico, with its head near small round leaves and no visible people.
This frame holds the same close wildlife composition for use as a steady insert. (0:01)
Close view of a green lizard beside sunlit foliage.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.