Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Windy Day Leads To Plenty Of Waves And Nice Walks On

6s 4K UHD 29.97fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A sunny day at the coastline in Los Cabos, Mexico, 2019, captured on home movie film. Windy conditions create lively waves crashing along the shore, with footprints visible in the sand. People enjoy leisurely walks along the beach, taking in the picturesque scenery. The natural beauty of the ocean and sky evokes a sense of calm and recreation. This authentic home movie footage offers a nostalgic glimpse into a relaxing day at the beach, perfect for travel, lifestyle, or nature-themed projects.

Clip Intelligence

Production use
Use this 4K Los Cabos beach view for travel edits, documentary scene setting, agency mood reels, brand films, or social cuts needing a windy shoreline with umbrella foreground and distant walkers.
Edit role
The short runtime works as a cutaway, transition, or atmospheric beat between people-led moments in a Mexico travel sequence, with waves and beach texture carrying the edit.
Visual details
A striped beach umbrella fills the top foreground, its pole near center, with rippled sand, foamy surf, distant walkers, low hills, shoreline buildings, and backlit sky across the frame.

Tags

umbrellasunnyfootprintssandcoastlinepicturesquesunsetwindydayleadsplentywavesnicewalksbeachsportsrecreationLOS cabos mexico C2019kind

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
70 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Feb 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Striped umbrella canopy and pole frame a Los Cabos beach with foamy surf, rippled sand, distant hills, shoreline buildings, and small walkers near the water.
The opening frame establishes the umbrella foreground and windy Los Cabos shoreline. (0:00)
The umbrella pole sits near center as waves break along the Los Cabos shoreline, with textured sand, tiny people near the surf, low hills, and backlit clouds.
This frame emphasizes the strong foreground pole and the line of surf running into the distance. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.