Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2019: A Carnival Worker Hands The Special Rifle To A Child

6s 4K UHD 29.97fps San Jose Del Cabo, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A carnival worker in San Jose del Cabo, Mexico, hands a special rifle to a child during a lively game booth at a summer fair. The vintage footage captures the playful energy of a family-friendly carnival, with bright colors and joyful interactions. The child prepares to aim at a target, embodying the fun and excitement of classic amusement park entertainment. This nostalgic clip showcases the charm of 2019 carnival culture with authentic, candid moments.

Clip Intelligence

Production use
Fits travel edits, documentary scenes, social cuts, and family culture segments needing a San Jose del Cabo carnival game moment with a worker handing a rifle prop to a child.
Edit role
Works as a short cutaway or interaction beat within a fair sequence, showing the handoff before a child plays a shooting gallery game.

Tags

shootwomenhelpingtoystargetaimentertainmentgunfunfamilycarnivalworkerhandsspecialriflechildreadywinprizesports

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
70 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2019
Published
Mar 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

In San Jose del Cabo, Mexico, a carnival worker in a striped shirt holds a rifle prop beside a child in a purple hood at a bright prize booth.
The opening frame shows the worker preparing the carnival game rifle for the child. (0:00)
In San Jose del Cabo, Mexico, the worker keeps the rifle prop upright while the child remains foregrounded at the colorful carnival counter.
This frame holds on the handoff setup at the shooting gallery booth. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.