Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

ARVADA COLORADO-2015: A Fawn-Colored Dog With A Short Tail Walks Through Snow In

6s 4K UHD 29.97fps Arvada, Colorado, United States 2015
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A fawn-colored dog with a short tail walks through snow in a rural winter landscape. This home movie captures a quiet moment of a dog exploring a snowy field during daylight. The scene evokes a sense of calm and simplicity, with the dog’s alert posture and natural surroundings creating a nostalgic, authentic feel. This vintage-style footage is ideal for documentaries, nature projects, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, brand film, social cut, or agency mood reel work needing a fawn-colored dog moving through a snowy rural Arvada, Colorado field in winter daylight.
Edit role
A short cutaway or quiet transition beat for a winter sequence, showing the dog entering, sniffing, pausing, and continuing through deep snow over seven seconds.
Visual details
A fawn-colored dog with a collar and short tail moves through blue-toned snow beside low vegetation and a flat distant horizon, with overcast daylight and no visible people.

Tags

browncollaralertruralwintercoldfawn-coloreddogshorttailwalkssnowfielddaylightanimalswildlifearvada colorado2015buybusiness

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
38 MB
Location
Arvada, Colorado, United States
Year filmed
2015
Published
Mar 2015

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A fawn-colored dog appears near the right edge of a snowy field in Arvada, Colorado, with a low horizon and no visible people.
The opening frame places the dog near the edge of the snowy landscape before it moves through the field. (0:00)
A fawn-colored dog lowers its head into the snow while walking across the Arvada field, with sparse plants and no visible people.
This frame shows the dog sniffing or investigating the snow as it crosses the field. (0:01)
Dog standing alert in deep snow facing right.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.