Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2019: A Girl Playing Soccer With The Boys On A Sunny Day

6s 4K UHD 29.97fps San Jose Del Cabo, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A young girl plays soccer with a group of boys on a sunny day in San Jose del Cabo, Mexico, in 2019. This home movie captures a candid moment of childhood joy and inclusion during a casual outdoor game. The natural light and spontaneous energy reflect a genuine slice of life from a modern family vacation. This vintage-style footage offers a nostalgic yet contemporary feel, perfect for storytelling about youth, sports, and community. Ideal for documentaries, editorial content, or nostalgic lifestyle projects.

Clip Intelligence

Production use
Useful for documentary, travel edit, school sports story, brand film, or social cut needing modern 4K footage of children playing soccer in San Jose del Cabo, Mexico.
Edit role
The six-second clip works as a quick cutaway, insert, or energy beat within a youth sports sequence, especially between wider field coverage and closer shots of individual children.
Visual details
Children in white and green soccer jerseys move across a grassy field in bright sun, with a stone wall, trees, dirt path, adults, and a bench in the background.

Tags

socceroutsideplayboysgirlkidschildrenplayingwmdaysportsrecreationSAN jose DEL cabo mexico2019home videohome movie4kcinematicb-rollmodern

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
80 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2019
Published
Jun 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children in green and white soccer jerseys move across a sunny grass field in San Jose del Cabo, Mexico, with adults cropped at the edge and a stone wall behind them.
This opening moment shows the mixed group of children entering the frame during the casual outdoor soccer game. (0:00)
Boys in white soccer kits and a girl in a green jersey walk and run near a stone wall in San Jose del Cabo, Mexico, with strong sunlight on the field.
The frame emphasizes the girl in green among boys in white kits during the short soccer-field passage. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.