Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

MESA COLORADO-2016: Mom Daughter Smiling Enjoying Time Near Vineyard With Family

6s 4K UHD 29.97fps Mesa, Colorado, United States 2016
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A heartwarming home movie from Mesa Colorado in 2016 captures a mother and daughter smiling and enjoying time together near a vineyard. The warm, sun-drenched footage shows a family gathering in a scenic outdoor setting, with natural light enhancing the joyful, intimate atmosphere. This authentic home movie footage reflects a carefree summer day filled with love and connection. Perfect for nostalgic storytelling, family-themed content, or editorial use in documentaries and lifestyle projects.

Clip Intelligence

Production use
Useful for documentary, family-history, travel, lifestyle, or social edits needing a real mother and young daughter moment in Mesa, Colorado with vineyard-adjacent outdoor context.
Edit role
A short human cutaway or emotional insert that can sit between landscape shots, family activity coverage, or a broader Mesa, Colorado travel sequence.
Visual details
A blonde woman in dark sunglasses and a young blonde girl in a pink floral dress sit on a metal mesh walkway with orange railings, strong sun, long shadows, and greenery beyond the railing.

Tags

love fun summer warm beautifulmomdaughtersmilingenjoyingtimevineyardfamilyfriendspeoplemesa colorado2016introabstractbusinessbuy

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
71 MB
Location
Mesa, Colorado, United States
Year filmed
2016
Published
Jul 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At the start of the Mesa, Colorado clip, a young blonde child in a pink floral dress is held close on a dark metal mesh walkway with sunlit rail shadows nearby.
This opening frame shows the child close to camera before the wider mother-daughter moment appears. (0:00)
One second in, the child remains close to the camera in Mesa, Colorado, with adult hands at her side and the textured walkway filling most of the background.
This frame emphasizes the handheld home-movie feel through close body framing and visible family touch. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.