Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2015: Little Green-Eyed Baby Plays In Front Of The Camera

6s 4K UHD 29.97fps Westminster, Colorado, United States 2015
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A charming 2015 home movie clip from Westminster, Colorado, featuring a bright-eyed infant with striking green eyes playing joyfully in front of the camera. The baby, dressed in red, giggles and moves with natural curiosity, capturing a tender, candid moment of childhood innocence. With a warm, nostalgic quality, this footage evokes feelings of love and wonder. Ideal for emotional storytelling, family documentaries, or nostalgic content.

Clip Intelligence

Production use
Fits family documentary scenes, parenting brand films, social cut inserts, and emotional archive-style edits needing a close home movie moment of an infant in Westminster, Colorado.
Edit role
Works as a short intimate cutaway or emotional beat within a family sequence, giving editors a close look at a baby reacting toward the camera over a few seconds.
Visual details
A green-eyed infant lies on deep red fabric in a pink floral outfit with an orange crochet flower, with an adult hand visible near the baby in several frames and soft indoor light on the face.

Tags

cutelovelychildrenkidprettyinfantgreen-eyedbabyplaysfrontcameraredbackgroundpeoplewestminster colorado C2015love4kstunningbeautiful

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
42 MB
Location
Westminster, Colorado, United States
Year filmed
2015
Published
Feb 2015

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At 0:00, a green-eyed infant in a pink floral outfit lies on red fabric in Westminster, Colorado, with an adult hand visible at the upper left.
The opening frame establishes the close home movie view of the baby against the red background. (0:00)
At 0:01, the infant looks toward the camera from the red blanket, with the floral outfit and orange flower detail visible in the foreground.
This frame gives editors a direct eye-contact moment from the baby. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.