Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

TULUM MEXICO-2015: Peaceful And Calm Beach Perfect For Weekend Escapade

6s 4K UHD 29.97fps Tulum, Mexico 2015
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

TULUM MEXICO-2015: A serene and tranquil beach scene unfolds with gentle waves lapping the shore under a clear sky. The calm waters and peaceful atmosphere capture the essence of a perfect weekend escape. Shot on home movie footage, this vintage footage offers a nostalgic glimpse of nature’s beauty in Tulum, Mexico. Ideal for travel, lifestyle, and relaxation content, this authentic 2015 home movie clip evokes calmness and wanderlust.

Clip Intelligence

Production use
Useful for a travel edit, documentary segment, agency mood reel, brand film, or social cut needing Tulum coastline, turquoise water, rocky foreground, and small boats without visible crowds.
Edit role
This six second clip works as a short coastal cutaway, transition beat, or calm opener between beach activity, ruins, or landscape shots from a Tulum sequence.
Visual details
A rocky outcrop with green coastal plants fills the right foreground, pale turquoise sea stretches across the frame, small boats sit offshore, a sandy beach lies in the distance, and no people are visible.

Tags

environmentbeachseapeacefulcalmperfectweekendescapadenaturetulum mexico C2015cinematicvideographybuyfootageintroprofessional

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
42 MB
Location
Tulum, Mexico
Year filmed
2015
Published
Mar 2015

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening frame of Tulum, Mexico coastline with a dark rocky outcrop and green plants at right, turquoise water across the middle, distant beach, small boats offshore, and no visible people.
The first moment frames the rock and plants against shallow blue green water and distant boats. (0:00)
Second frame holds the Tulum shoreline view with the rocky foreground slightly right of center, pale turquoise water, small offshore boats, a distant sandbar or beach, and no visible people.
This frame keeps the coastline composition steady while boats sit across the horizon side of the water. (0:01)
Coastal rock with plants beside bright shallow sea and boats.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.