Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2015: A Sweet Baby Lying On His Quilt Looking Up With Eyes

6s 4K UHD 29.97fps Westminster, Colorado, United States 2015
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A sweet newborn baby lies on a quilt in Westminster, Colorado, in 2015, gazing upward with wide, curious eyes. The infant coos softly, occasionally fidgeting and sticking out his tongue in a natural, innocent moment. This home movie captures the tender emotions of early life with a warm, nostalgic glow. The baby’s tiny hands move gently as he explores his surroundings, embodying pure joy and wonder. This intimate, candid footage is perfect for family-themed projects, emotional storytelling, or nostalgic content creation.

Clip Intelligence

Production use
Useful for family documentary scenes, parenting brand films, childcare pieces, memory montages, and social edits needing a close view of an infant on a quilt in Westminster, Colorado.
Edit role
This short clip works as an intimate insert or emotional beat between broader family scenes, giving an editor a six-second closeup of a baby reacting quietly to someone above the camera.
Visual details
A baby lies on a multicolored patchwork quilt, bare shoulders and face filling the foreground, with soft indoor light, pink cheeks, dark eyes, and changing expressions visible across the frames.

Tags

cutenewborncooingfidgetlittlediapertongueplayfaceinnocentfamilyhappyminilearnteachsweetbabylyingquilteyes

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
41 MB
Location
Westminster, Colorado, United States
Year filmed
2015
Published
Mar 2015

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A baby in Westminster, Colorado lies diagonally on a multicolored quilt with eyes partly closed and a small smile at the start of the clip.
The opening frame shows the infant smiling softly on the patterned quilt. (0:00)
A close view shows the baby on the quilt in Westminster, Colorado with a wider grin, rosy cheeks, and eyes narrowed in a playful expression.
This moment gives editors a clear smiling infant reaction for a family sequence. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.