Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Timelapse Of A Car Traveling Through A Beautiful (Coast, 2019)

5s 4K UHD 29.97fps Road Coast, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Central Coast California-2019: Timelapse of a car traveling through a scenic highway, capturing the motion of traffic and the beauty of the coastal landscape. The smooth motion and vibrant visuals evoke a sense of movement and freedom, ideal for projects exploring travel, emotion, or contemporary life. Perfect for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for travel edits, road-trip documentaries, agency mood reels, brand films, and social cuts needing a 2019 Central Coast California highway drive through rolling hills and light traffic.
Edit role
This short timelapse works as a road-transition beat, driving insert, or momentum cutaway between locations, with enough passing roadway and traffic variation to bridge a travel sequence.
Visual details
The frames show a highway seen through a vehicle windshield, with cars and trucks ahead, guardrails, dry hills, green patches, roadside trees, blue sky, and no visible people.
Shot mechanics
The viewpoint is from inside or just behind the front windshield of a moving vehicle, with the hood and wipers in the foreground, traffic in the midground, and hills and sky on the horizon.

Tags

carstraveltime lapsehighwaytraffictimelapsecartravelingbeautifultransportationcentral COAST californiainspirationromancenewamateurloveemotion4k

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
64 MB
Location
Coast, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A Central Coast California highway is viewed through a vehicle windshield, with cars ahead, a guardrail, dry rolling hills, blue sky, and no visible people.
The opening frame establishes the in-car highway perspective with traffic moving through open hill country. (0:00)
The windshield view continues along a Central Coast California highway, with several cars in the lanes ahead, roadside brush, a metal barrier, pale hills, and no visible people.
This frame gives editors a clean highway travel insert with vehicles spaced across the road. (0:01)
A more open stretch of Central Coast California highway appears through the windshield, with fewer nearby cars, guardrails, roadside signs, hillside vegetation, and no visible people.
The clip shifts into a clearer road view with more empty lane space for a transition beat. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.