Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CENTRAL COAST CALIFORNIA-2019: Timelapse Of A Car Traveling Through A Beautiful

5s 4K UHD Coast, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Central Coast California-2019: Timelapse of a car traveling through a scenic highway, capturing the motion of traffic and the beauty of the coastal landscape. The smooth motion and vibrant visuals evoke a sense of movement and freedom, ideal for projects exploring travel, emotion, or contemporary life. Perfect for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for travel edits, road-trip documentaries, agency mood reels, brand films, and social cuts needing a 2019 Central Coast California highway drive through rolling hills and light traffic.
Edit role
This short timelapse works as a road-transition beat, driving insert, or momentum cutaway between locations, with enough passing roadway and traffic variation to bridge a travel sequence.

Tags

carstraveltime lapsehighwaytraffictimelapsecartravelingbeautifultransportationcentral COAST california2019inspirationromancenewamateurloveemotion4k

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Coast, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A Central Coast California highway is viewed through a vehicle windshield, with cars ahead, a guardrail, dry rolling hills, blue sky, and no visible people.
The opening frame establishes the in-car highway perspective with traffic moving through open hill country. (0:00)
Vehicle windshield view of highway traffic with hills and shrubs along the shoulder.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.