Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

OJAI CALIFORNIA-2019: Large Yellow Flames Jumping From Small Controlled Campfire

5s 4K UHD Ojai, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The flickering firelight casts a calming glow, evoking a sense of peace and connection with nature. The natural movement of the flames and the soft glow create a visually soothing and immersive experience, ideal for modern digital projects seeking authentic, heartfelt moments.

Clip Intelligence

Production use
Useful for documentary inserts, travel edits, agency mood reels, brand films, and social cuts needing a dark Ojai campfire detail with yellow flames and glowing embers.
Edit role
A short insert or transition beat that can bridge night scenes, introduce a campfire sequence, or close a quiet outdoor moment in a five-second edit slot.

Tags

fireflamescampfirenightwarmcalminglargeyellowjumpingsmallcontrollednightienatureojai california2019professionaldigitalintroabstract

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Ojai, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A yellow campfire flame rises from a small fire in Ojai, California, with red embers scattered in the dark background and no visible people.
The opening frame shows the campfire flame isolated against a black night setting. (0:00)
A taller yellow flame curls upward from the Ojai campfire, with faint red embers behind it and no visible people.
This frame captures the flame stretching higher while the surrounding fire bed stays mostly dark. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.