Low-resolution preview (256x144) for evaluation. The licensed download is the clean HD 1080p master at the stated resolution.

Download the free low-res preview to test in your edit

Large Yellow Flames Jumping From Small Controlled Campfire (Ojai, 2019)

5s HD 1080p 29.97fps Nature Ojai, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The flickering firelight casts a calming glow, evoking a sense of peace and connection with nature. The natural movement of the flames and the soft glow create a visually soothing and immersive experience, ideal for modern digital projects seeking authentic, heartfelt moments.

Clip Intelligence

Production use
Useful for documentary inserts, travel edits, agency mood reels, brand films, and social cuts needing a dark Ojai campfire detail with yellow flames and glowing embers.
Edit role
A short insert or transition beat that can bridge night scenes, introduce a campfire sequence, or close a quiet outdoor moment in a five-second edit slot.
Visual details
Large yellow flames rise from a small controlled campfire against a mostly black background, with red embers and tiny sparks visible around the fire and no people visible.
Shot mechanics
The frames hold a tight, low-light composition on the fire, with the flame in the lower center area and surrounding embers fading into darkness.

Tags

fireflamescampfirenightwarmcalminglargeyellowjumpingsmallcontrollednightienatureojai californiaprofessionaldigitalintroabstract

Shot slate

Resolution
1920 × 1080
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
2 MB
Location
Ojai, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A yellow campfire flame rises from a small fire in Ojai, California, with red embers scattered in the dark background and no visible people.
The opening frame shows the campfire flame isolated against a black night setting. (0:00)
A taller yellow flame curls upward from the Ojai campfire, with faint red embers behind it and no visible people.
This frame captures the flame stretching higher while the surrounding fire bed stays mostly dark. (0:01)
A narrow yellow flame leans to the right over the small Ojai campfire, with sparse sparks and red ember patches visible in the darkness and no visible people.
The frame shows the fire briefly forming a thin, leaning shape for a quick texture cut. (0:02)
A compact yellow flame rises from the low Ojai campfire, with dim red embers above and around it and no visible people.
This moment gives a smaller flame profile with the ember glow still visible in the black frame. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant download of the HD 1080p master with a license PDF, direct from filmmaker Phil Maher.