Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2015: Mother Teaching Small Adorable Baby How To Swim In A

6s 4K UHD 29.97fps Westminster, Colorado, United States 2015
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A heartwarming home movie from 2015 captures a mother gently teaching her adorable baby how to swim in a pool. Shot in Westminster, Colorado, this intimate family moment showcases tender bonding and early childhood development. The footage reflects the warmth of a summer day, with natural light and candid emotion. Ideal for documentaries, parenting content, or nostalgic family narratives, this vintage-style home movie offers authentic, emotional storytelling from a real-life moment.

Clip Intelligence

Production use
Fits parenting documentaries, family health segments, childcare brand films, and social edits needing a real mother and baby swim lesson in Westminster, Colorado.
Edit role
Use as a short insert or emotional beat showing parent-child bonding in water, with enough variation for a quick cutaway inside a family or early childhood sequence.
Visual details
A woman in a black swimsuit holds a baby wearing a bright pink and purple flotation vest in a green indoor pool, with rippling water filling the frame and people visible throughout.

Tags

adorablechildmotherbabypoolswimmingfamilyteachingsmallswimpeoplewestminster colorado C2015b-rollkindamateurintroductionbusinessnew

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
41 MB
Location
Westminster, Colorado, United States
Year filmed
2015
Published
Aug 2015

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A woman in a black swimsuit supports a baby in a pink and purple flotation vest in a Westminster, Colorado pool as the baby's leg kicks water.
This opening frame shows the close parent-child swim lesson setup in the pool. (0:00)
The baby leans back in the bright flotation vest while the woman holds them close in the Westminster, Colorado pool and a splash appears near the baby's foot.
This frame gives editors a clear baby swimming practice moment with visible kicking. (0:01)
Woman lifts baby in flotation vest above green pool water.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.