Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View Of An Empty Street With Lights During The Night

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of an empty street at night in Hidden Lake Colorado, 2016,. Glowing streetlights trace quiet pathways through the dark urban landscape, with illuminated buildings and distant landmarks creating a serene, cinematic glow. The stillness of the scene evokes a sense of solitude and modern quietude, offering a nostalgic glimpse of a city at rest. This vintage footage provides atmospheric b-roll for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, brand film, or social cut needing a night aerial of an empty road in Hidden Lake, Colorado.
Edit role
Works as a short atmospheric opener, transition, or quiet cutaway between brighter daytime neighborhood shots in a Colorado location sequence.
Visual details
A dark overhead view shows an empty paved street running diagonally through frame, amber streetlights pooling on the road, shadowed trees and structures nearby, and no visible people.

Tags

aerialemptystreetlightsnightviewdarkknightbuildingslandmarkshidden lake colorado2016businesscurrentstunningprettyb-rollcinematographyintroductionamateur

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead night frame in Hidden Lake, Colorado showing an empty diagonal street lit by amber streetlights, with dark lots and no visible people.
The opening frame establishes the empty road and warm streetlight pools from above. (0:00)
Aerial night view in Hidden Lake, Colorado with the empty street crossing diagonally and a bright streetlight spot near the upper road edge, no visible people.
This moment holds on the same empty roadway with the brightest light concentrated along the upper section. (0:01)
Top-down night street scene with a warm light pool and dark surroundings.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.