Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View Of A Dark City With No Light In The Scene

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of a dark city at night in 2016,. The scene is enveloped in shadow with no visible lights, creating a mysterious and moody atmosphere. Shot from above, the urban landscape appears still and quiet, with silhouetted buildings and structures barely visible against the night sky. This vintage footage offers a rare, intimate glimpse of a city in darkness, evoking a sense of solitude and intrigue. Ideal for cinematic projects, documentaries, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, agency mood reel, brand film, or social edit needing a very dark aerial night view of Hidden Lake, Colorado without crowds or readable street activity.
Edit role
This short clip works as a shadowy transition, ominous texture beat, or brief nighttime insert between brighter residential aerials in a sequence.
Visual details
The frames show an overhead night view with mostly black terrain, faint warm points of light, barely readable building or street shapes, deep blue-black color, and no visible people.

Tags

scenedarkcitylandscapeaerialviewlightbuildingslandmarkshidden lake colorado2016newb-rollamateurkindemotionabstractinspiration

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening frame of Hidden Lake, Colorado from above at night, with scattered faint lights and no visible people.
The clip begins on a nearly black overhead view with only small points of warm light breaking through. (0:00)
Hidden Lake, Colorado aerial frame at 0:01, showing a mostly black scene with tiny light sources and no visible people.
This second moment keeps the frame almost fully in shadow, useful as a low-light texture. (0:01)
Dark aerial view with a small illuminated patch near the upper frame.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.