Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: An Aerial View Of A Dark City Landscape

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of a dark city landscape captured in 2016, showcasing illuminated buildings and urban structures against a night sky. This home movie footage offers a cinematic glimpse of a modern city at night, with a moody and atmospheric tone. The scene evokes a sense of mystery and quiet beauty, ideal for storytelling, emotional narratives, or urban-themed projects. The clip carries a nostalgic, analog quality that enhances its cinematic appeal. Perfect for documentaries, editorial content, or creative projects exploring urban life, inspiration, and modern landscapes.

Clip Intelligence

Production use
Use this short 4K aerial night clip for a documentary, travel edit, agency mood reel, brand film, or social cut needing a dark Colorado residential landscape with sparse house and street lighting.
Edit role
The clip works best as a brief nocturnal cutaway, transition beat, or atmospheric insert between brighter daytime neighborhood aerials in a Hidden Lake sequence.
Visual details
The frames show a very dark aerial view with small warm and cool lights from buildings or streets, deep black open areas, faint roof or road shapes, and no visible people.

Tags

scenedarkcitylandscapeaerialviewbuildingslandmarkshidden lake colorado2016stunningloveemotioninspirationcamerabuycurrentproromance

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening frame of Hidden Lake, Colorado at night from above, with scattered warm lights and a small cool light visible against mostly black terrain, no visible people.
The first frame sets the clip's low-light aerial view with only a few illuminated structures breaking the darkness. (0:00)
Early frame of the Hidden Lake night aerial, showing sparse warm building lights and faint dark land shapes with no visible people.
This moment provides a quiet night insert where the landscape is mostly shadow with a few points of light. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.