Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Gray Car-Free Parking Person Walking Empty Streets

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A quiet, contemplative scene from 2016 in Hidden Lake Colorado,. A lone person walks through an empty parking lot, passing gray cars under a muted sky. The stillness of the car-free streets and surrounding green lawn evoke a sense of solitude and urban quiet. This vintage footage offers a nostalgic glimpse into a moment of calm, ideal for cinematic storytelling, ambient B-roll, or reflective editorial content.

Clip Intelligence

Production use
Useful for documentary, municipal, real estate, or brand-film edits needing a quiet 2016 aerial view of an empty parking lot and park edge in Hidden Lake, Colorado.
Edit role
Works as a short cutaway or transition beat between neighborhood aerials, using the empty pavement, sidewalk, and lone walker to signal a pause in a suburban sequence.
Visual details
The frames show a mostly empty gray parking lot with yellow and white stall lines, a sidewalk, green lawn, benches, soccer goals, small landscaped islands, and a tiny person walking near the top edge.

Tags

parkinggraycarspersonlawncar-freewalkingemptystreetsgreenobjectsindustrialhidden lake colorado2016videographyhome videostunningbusiness

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead frame in Hidden Lake, Colorado showing an empty gray parking lot, yellow stall lines, a sidewalk, lawn, benches, soccer goals, and a tiny person near the top edge.
This opening frame sets the empty parking area against the adjacent green park strip. (0:00)
Hidden Lake, Colorado aerial frame with the parking lot centered, a curved curb at left, landscaped islands, park grass above the sidewalk, and a distant person walking near the top.
The second frame keeps the lot markings and sidewalk as the main usable details. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.