Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View of A Village Filled With Healthy Trees

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial home movie footage from 2016 captures a quiet village nestled among lush green trees, with rooftops and buildings visible beneath a clear sky. The natural landscape features dense foliage and a serene, rural atmosphere, offering a nostalgic glimpse of a peaceful community. Shot on vintage film, this clip showcases rich color and texture, ideal for storytelling, travel, or nature-themed projects. The hidden lake in Colorado adds a sense of discovery and tranquility, making it perfect for documentaries, editorial content, or nostalgic visuals.

Clip Intelligence

Production use
Aerial neighborhood b-roll for documentary, travel edit, agency mood reel, brand film, or social cut needing a 2016 view of Hidden Lake, Colorado homes, rooftops, streets, and mature trees.
Edit role
Use as a short opener, transition, or cutaway between closer street-level material and wider residential-area coverage in a town or community sequence.
Visual details
The frames show gray rooftops, residential streets, autumn-colored trees, distant houses, a yellow vehicle, and a clear blue sky, with no visible people.

Tags

houseneighborhoodrooftopgrasstreeaerialviewvillagefilledhealthytreesbuildingslandmarkshidden lake colorado2016b-rollpromoderncinematographycurrent

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial frame over Hidden Lake, Colorado showing gray rooftops, yellow-orange trees, houses, a street, and no visible people.
The opening frame presents the residential area from above the roofs with fall-colored trees filling the midground. (0:00)
Second aerial frame in Hidden Lake, Colorado with a broad blue sky above rooftops, leafy trees, distant houses, and no visible people.
This moment keeps the camera above the neighborhood, showing the tree canopy between rooftops and streets. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.