Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View Of A City Landscape On A Bright Sunny Day

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of a sprawling city landscape in Hidden Lake, Colorado,. The bright sunny day highlights clear blue skies and a vibrant urban environment with numerous buildings and landmarks. This vintage home movie footage offers a nostalgic glimpse of modern city life, perfect for cinematic storytelling, travel content, or historical documentation. The natural lighting and wide-angle perspective create a stunning, emotionally resonant scene ideal for documentaries, editorial projects, and nostalgic media.

Clip Intelligence

Production use
Useful for documentary, local news, travel edit, agency mood reel, or brand film needing a 2016 aerial view of Hidden Lake, Colorado residential and light industrial blocks under clear sun.
Edit role
The short overhead view works as an opener, geographic cutaway, transition, or neighborhood context beat between ground-level town scenes in a longer sequence.
Visual details
Frames show low-rise homes, small commercial buildings, parking areas, roads, trees with fall color, dry open lots, distant suburban sprawl, a level horizon, blue sky, and no visible people.

Tags

clearblueskyaerialviewlargecitylandscapebrightsunnydaybuildingslandmarkshidden lake colorado2016beautifulinspirationromancefootagecute

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide aerial frame over Hidden Lake, Colorado with rooftops and streets in the foreground, low-rise buildings and trees beyond, and no visible people.
The opening frame presents the town from above with residential blocks and small commercial roofs in clear daylight. (0:00)
Aerial view across Hidden Lake, Colorado showing a diagonal road, clustered homes, small business lots, autumn-colored trees, and no visible people.
This frame gives a clear mid-clip look at the neighborhood grid and roadside buildings. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.