Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View Of Paved Roads Near The Beach With Some

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial home movie footage from 2016 captures a scenic view of paved roads winding near a beach in Hidden Lake, Colorado. The clip showcases a mix of natural landscapes and man-made infrastructure, including fields, buildings, and streets under bright daylight. This vintage-style Super 8 recording offers a nostalgic glimpse of modern rural development, blending nature with human settlement in a serene, sun-drenched setting. Ideal for documentaries, travel content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, local development, travel edit, agency mood reel, or brand film sections needing a 2016 aerial view of roads, sports fields, parking, construction, and lakeshore in Hidden Lake, Colorado.
Edit role
The short overhead view works as a location cutaway, map-like transition, or brief insert between neighborhood, road, and waterfront shots in a broader sequence.

Tags

aerialbeachbuildingsstreetsfieldsdayviewpavedroadsbeautifulnaturehidden lake colorado2016modernhome videobuyarthome movie

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over Hidden Lake, Colorado showing a paved road between empty parking areas, dry grass, green soccer fields, a construction site by the water, and no visible people.
The clip opens with a wide overhead look at roads, parking, athletic fields, and a lakeside construction area. (0:00)
Aerial frame in Hidden Lake, Colorado with the road running diagonally beside a lakeshore construction site, empty parking spaces, sports fields, and no visible people.
This moment emphasizes the diagonal road layout and the relationship between the construction site and water. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.