Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Fantastic Aerial View Of A City Landscape On A Sunny

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial footage from 2016 captures a stunning cityscape under a clear blue sky, showcasing sprawling urban development and distant landmarks. The vibrant, sunny day highlights the city's architecture and surrounding landscape, offering a cinematic view of modern urban life. Shot on home movie film, this clip delivers a nostalgic yet professional aesthetic ideal for documentaries, travel content, or creative storytelling.

Clip Intelligence

Production use
Aerial footage for a documentary, regional development piece, agency mood reel, or brand film needing suburban Colorado roads, shopping-center parking, housing, and mountain horizon in one view.
Edit role
Useful as a short opener, transition, or location cutaway that quickly places a Hidden Lake, Colorado sequence in a built suburban area with distant mountains.
Visual details
The frames show a broad road intersection in the foreground, rows of townhomes, a large parking lot, commercial buildings, open lots, trees, and a blue sky with no visible people.

Tags

clearblueskyaerialviewlargefantasticcitylandscapesunnydaybuildingslandmarkshidden lake colorado2016digitalabstractstock videofootage

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
41 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Oct 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over Hidden Lake, Colorado with a wide road intersection, townhouse rows, retail parking, tree-lined neighborhoods, distant mountains, and no visible people.
The first frame sets the suburban layout with roads, housing, parking, and mountain horizon visible at once. (0:00)
Aerial frame over Hidden Lake, Colorado showing a large retail parking lot beside townhomes, a multi-lane road in front, open land beyond, and no visible people.
This moment emphasizes the relationship between the shopping-center lot, adjacent housing, and the arterial road. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.