Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2015: Baby Girl Laying On A Pink-Violet Pattern Baby Gym

6s 4K UHD 29.97fps Westminster, Colorado, United States 2015
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A baby girl lies on a pink-violet patterned baby gym in this 2015 home movie footage from Westminster, Colorado. The infant is surrounded by soft plastic toys, including a plush elephant, and appears to be holding small keys. The clip captures a quiet, intimate moment of early childhood with warm, natural lighting and a gentle, playful atmosphere. This authentic home video offers a nostalgic glimpse into family life and early development.

Clip Intelligence

Production use
Documentary editors, family-history producers, parenting brands, and social cut teams can use this Westminster, Colorado home movie clip for an intimate early-childhood moment on a baby play mat.
Edit role
The 6-second clip works as a short insert or gentle cutaway within a parenting, childhood development, family archive, or domestic-life sequence.

Tags

babygirlbaby gymelephantkeysdiaperlayingpink-violetpatterngymholdingplasticsofttoypeoplewestminster colorado C2015b-rollabstracthome movie

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
40 MB
Location
Westminster, Colorado, United States
Year filmed
2015
Published
May 2015

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At 0:00, a baby girl lies on her stomach on a pink and violet baby gym in Westminster, Colorado, with a plush elephant and hanging toys around her.
The opening frame shows the baby centered on the play mat with toys framing the home movie scene. (0:00)
At 0:01, the baby girl remains on her stomach in Westminster, Colorado, looking forward beside colorful plastic keys and a beige plush elephant.
This frame gives editors a clear view of the infant's face and the play objects near her hands. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.