Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Aerial View of a Green Empty Lot for Sale

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of a green, empty lot in Hidden Lake Colorado, captured in 2016. This home movie footage shows a quiet, undeveloped parcel surrounded by grass and trees, with a clear sky above. The scene evokes a sense of potential and rural tranquility, ideal for real estate, development, or landscape storytelling. This clip offers a nostalgic, cinematic perspective of modern American land use and suburban expansion.

Clip Intelligence

Production use
Useful for documentary, real estate, planning, or local-news edits about undeveloped land, suburban growth, parks, and community facilities in Hidden Lake, Colorado.
Edit role
A short aerial cutaway or transition beat for moving from residential streets to an open parcel and nearby civic-style building within a neighborhood sequence.
Visual details
The frames show a pale green grassy lot crossed by concrete paths, a two-lane road, parked and moving vehicles, nearby homes, trees, and a large brick building with a playground area in bright daylight.

Tags

vehiclebuildingroadskygrassaerialviewgreenemptylotsaletransportationhidden lake colorado2016home videointrohome moviemoderndigital4k

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial frame over a grassy lot in Hidden Lake, Colorado, with diagonal sidewalks, a road across the top, nearby homes, parked vehicles, and scattered trees.
The opening frame places the open lot within a residential street grid. (0:00)
Aerial view of the Hidden Lake, Colorado lot with pale grass, intersecting concrete paths, a road and homes at the top edge, and small trees casting short shadows.
This moment keeps the vacant parcel central while showing the surrounding road access. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.