Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: Fantastic City Landscape With Clear Blue Sky Above

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of a stunning city landscape in Hidden Lake, Colorado, captured in 2016. The clear blue sky stretches above modern buildings and urban landmarks, offering a vibrant and cinematic perspective. This home movie footage showcases a bright, open environment with a sense of wonder and scale. The natural light enhances the colors and textures of the city, creating a visually rich and emotionally uplifting scene. Ideal for documentaries, travel content, or nostalgic presentations.

Clip Intelligence

Production use
Useful for documentary, real estate context, local-news, agency mood reel, or social edits needing a 2016 aerial view of residential Hidden Lake, Colorado under a clear blue sky.
Edit role
Best as a brief opener, transition, or geographic cutaway before a neighborhood story, housing segment, town profile, or broader Colorado suburb sequence.
Visual details
The frames show rooftops, residential streets, leafless and evergreen trees, open lots, distant low-rise buildings, hazy mountains on the horizon, strong daylight, blue sky, and no visible people.

Tags

clearblueskyaerialviewlargefantasticcitylandscapebuildingslandmarkshidden lake colorado2016businesscurrentstunningprettyb-rollcinematographyintroduction

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over Hidden Lake, Colorado with rooftops and tree-lined streets in the foreground, distant buildings and mountains on the horizon, and no visible people.
The first frame sets the clip with a broad daytime view across a residential area and distant horizon. (0:00)
Second frame of Hidden Lake, Colorado showing residential blocks, bare trees, open ground, distant town structures, a pale mountain line, and no visible people.
This moment keeps the neighborhood grid readable while showing the town spreading toward open land. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.