Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

HIDDEN LAKE COLORADO-2016: An Aerial View Of A City Landscape And A Clear Blue Sky

5s 4K UHD 29.97fps Hidden Lake, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of a sprawling city landscape in HIDDEN LAKE COLORADO from 2016, captured on home movie film. The clear blue sky stretches over a dense urban environment with numerous buildings and landmarks. This vintage home movie footage offers a nostalgic glimpse of modern city life, showcasing wide streets, residential zones, and commercial structures from above. The natural lighting and film grain give it a cinematic, authentic feel ideal for documentaries, travel content, or historical presentations.

Clip Intelligence

Production use
Aerial 4K footage for documentary, civic planning, education, agency mood reels, or regional brand films needing a lakeside suburban Colorado view with a large modern building and surrounding neighborhoods.
Edit role
Use this short clip as an opener, geography cutaway, or transition beat between neighborhood, road, and waterfront material in a Hidden Lake sequence.

Tags

clearblueskyaerialviewlargecitylandscapebuildingslandmarkshidden lake colorado2016professionalbuyhome videofootagedigitalbusinessvideography

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Hidden Lake, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial frame over Hidden Lake, Colorado showing a large modern building, curved road, shoreline water, dry open ground, distant houses, blue sky, and no visible people.
The opening frame establishes the waterfront road, modern building, and surrounding suburban area. (0:00)
Aerial frame in Hidden Lake, Colorado with more of the curved roadway visible below the large glass building, lake water at the lower edge, distant neighborhoods, and no visible people.
This moment keeps the road and shoreline prominent while holding the large building across the center of frame. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.