Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

DENVER COLORADO-2016: Dark Night-Time View With Lights On Side Of Waterfront

5s 4K UHD Denver, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A dark night-time view from Denver, Colorado in 2016, showcasing illuminated buildings and lights along the waterfront. The scene captures a serene urban nightscape with reflections on the water, creating a cinematic and romantic atmosphere. Shot on digital home movie equipment, this 5-second clip offers a nostalgic glimpse of the city’s skyline at night, ideal for intros, B-roll, or ambient background footage. The quiet, contemplative mood highlights the beauty of urban life after dark, with glowing lights contrasting against the dark sky.

Clip Intelligence

Production use
Useful for a Denver travel edit, documentary night sequence, agency mood reel, brand film, or social cut needing a dark waterfront view with scattered city lights and no visible people.

Tags

nightdarklightsviewwaternight-timesidewaterfrontbuildingslandmarksdenver colorado2016digitalabstractstock videofootageintro

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Denver, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Dark waterfront at night with distant lights

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.