Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

DENVER COLORADO-2016: Dark Night-Time View With Lights On Side Of Waterfront

5s 4K UHD 29.97fps Denver, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A dark night-time view from Denver, Colorado in 2016, showcasing illuminated buildings and lights along the waterfront. The scene captures a serene urban nightscape with reflections on the water, creating a cinematic and romantic atmosphere. Shot on digital home movie equipment, this 5-second clip offers a nostalgic glimpse of the city’s skyline at night, ideal for intros, B-roll, or ambient background footage. The quiet, contemplative mood highlights the beauty of urban life after dark, with glowing lights contrasting against the dark sky.

Clip Intelligence

Production use
Useful for a Denver travel edit, documentary night sequence, agency mood reel, brand film, or social cut needing a dark waterfront view with scattered city lights and no visible people.
Edit role
The short runtime works best as an atmospheric opener, quiet transition, nighttime texture, or closing beat between brighter city or family scenes from the same 2016 Denver collection.
Visual details
The frames show a nearly black waterfront scene with small warm and white lights along the far side, faint reflections on dark water, deep blue-black shadow, and no visible people.

Tags

nightdarklightsviewwaternight-timesidewaterfrontbuildingslandmarksdenver colorado2016digitalabstractstock videofootageintro

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Denver, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Denver, Colorado nighttime waterfront view with a thin row of distant lights near the top of the frame and no visible people.
The opening frame establishes the dark water and sparse shoreline lights that define the clip. (0:00)
Denver, Colorado night frame showing mostly black water or sky with small warm lights scattered along the far waterfront and no visible people.
This moment keeps the frame minimal, with only small points of light marking the far side of the water. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.