Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2016: Aerial View of Desert Highway with Parked Cars and Rectangular Buildings

5s 4K UHD 29.97fps Westminster, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial footage from Westminster, Colorado in 2016 captures a vast desert highway with parked cars along the roadside. The scene features rectangular structures and industrial buildings under a clear sky, showcasing modern urban development in a remote landscape. Shot on home movie equipment, this cinematic clip offers a unique perspective of contemporary American infrastructure and open-road travel. Ideal for documentaries, travel content, or modern Americana projects.

Clip Intelligence

Production use
Useful for documentary, city planning, infrastructure, real estate, or brand edits needing a 2016 aerial view of Westminster, Colorado roadways, storage buildings, parked vehicles, and dry open lots.
Edit role
Works as a brief aerial cutaway or transition beat between street-level scenes, adding context for industrial edges, suburban roads, and open developed land within a five-second sequence.
Visual details
The frames show white rectangular storage buildings, paved lots, parked trucks and cars, a curved road, a larger multilane road, dry grass, dirt lots, and hard midday light with no visible people.

Tags

droneurbanindustrialdesertcarsbuildingsroadaerialviewhighwayparkedrectangularwestminster colorado2016cinematographybeautifullovefootagecinematic

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Westminster, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view in Westminster, Colorado showing white rectangular storage buildings, paved lots, a curved road, dry open ground, and no visible people at the start of the clip.
The opening frame establishes the storage buildings, road network, and dry suburban-industrial surroundings. (0:00)
Overhead Westminster, Colorado frame with long white storage rows, a larger roofed building, roadside vehicles, dry lots, and no visible people.
This second shows the same industrial block from above with the road and storage rows clearly separated. (0:01)
Aerial frame of storage units, parked vehicles, and curved roadway.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.