Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2016: An Aerial View Of A City Landscape

5s 4K UHD 29.97fps Westminster, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of Westminster, Colorado in 2016, captured on home movie film. The clip showcases a sprawling city landscape under a clear blue sky, with modern buildings and urban landmarks visible from above. Shot with a handheld camera, the footage has a natural, unfiltered quality typical of amateur home movies. This cinematic 4k-style home video offers a nostalgic glimpse into suburban life and urban development in the 2010s. Ideal for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, local news, real estate context, civic planning, or brand films needing a 2016 aerial view of suburban Westminster, Colorado near a broad body of water.
Edit role
Works as a short opener, transition, or geographic cutaway that places a sequence above a residential city edge before moving into closer family, zoo, or neighborhood material from the same collection.
Visual details
The frames show dark water in the foreground, a shoreline with docks and grass, dense low-rise homes and streets across the midground, distant mountains, blue sky, layered clouds, and no visible people.

Tags

clearblueskyaerialviewlargecitylandscapebuildingslandmarkswestminster colorado2016cinematographybeautifullovefootagecinematicmoderncamera

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Westminster, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame of Westminster, Colorado with dark water in the foreground, docks along the shore, dense residential blocks beyond, distant mountains, layered clouds, and no visible people.
The first frame establishes the waterline and broad suburban cityscape from above. (0:00)
Westminster, Colorado aerial view one second in, with the shoreline slightly shifted, small docks near the lower left, a broad field of houses, distant hills, and no visible people.
This moment keeps the lake edge in the foreground while showing the scale of the residential area. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.