Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2016: A View Of Many Tightly Colorful Parked Cars In A

5s 4K UHD 29.97fps Westminster, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

WESTMINSTER COLORADO-2016: A view of many tightly parked colorful cars in a lot, with a nostalgic, home movie aesthetic. The vibrant hues and compact arrangement create a visually striking urban scene, evoking the charm of everyday life in a modern American suburb. This candid, cinematic clip offers a glimpse into 2016 community life, perfect for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, editorial, agency mood reel, or local business pieces needing an aerial view of tightly packed parked cars in Westminster, Colorado.
Edit role
The short 7-second clip works as an opener, transition, or cutaway for a sequence about parking, auto inventory, traffic infrastructure, or suburban commercial land use.
Visual details
Rows of colorful parked cars fill a large dirt and gravel lot, with access roads, industrial storage areas, white trailers, scattered equipment, and no visible people in the frames.

Tags

carscolorfulparkinglotstreetviewtightlyparkedtransportationwestminster colorado2016cinematicintrostunninghome moviebusinessartamatuer

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Westminster, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over a large Westminster, Colorado car lot packed with rows of colorful parked vehicles, dirt roads, storage areas, and no visible people.
The opening frame shows the scale of the vehicle-filled lot from above. (0:00)
High overhead view in Westminster, Colorado showing compact rows of cars beside a long dirt access road, white trailers, industrial yard space, and no visible people.
This frame emphasizes the orderly rows and surrounding service-yard layout. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.