Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WESTMINSTER COLORADO-2017: Aerial View of Lake and Green Landscape

6s 4K UHD 29.97fps Westminster, Colorado, United States 2017
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of a serene lake in Westminster, Colorado,. The lush green landscape surrounds the calm water, reflecting the clear sky above. This home movie footage showcases natural beauty with a cinematic, nostalgic feel, perfect for nature-themed projects, travel montages, or environmental storytelling. The tranquil scene evokes peace and connection to the outdoors, offering a timeless glimpse of local scenery.

Clip Intelligence

Production use
Useful for travel edits, local documentary context, agency mood reels, brand films, or social cuts needing an overhead Westminster, Colorado lake view with marina edges and green shoreline.
Edit role
The short aerial works as a brief opener, transition, or water-texture cutaway between neighborhood, weather station, or outdoor recreation material in a Westminster sequence.
Visual details
Frames show green lake water from directly overhead, bright sun glare on the surface, partial covered docks and small boats at the edge, a rocky shoreline, grass, trees, and no visible people.

Tags

watergreenhumannaturewetlakeskyanimalswildlifewestminster colorado2017introductionb-rollbeautifullovecinematicmodern

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
45 MB
Location
Westminster, Colorado, United States
Year filmed
2017
Published
Jun 2017

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Top-down aerial view of a Westminster, Colorado lake with green water, a row of covered dock slips at the left edge, bright sun reflection, and no visible people.
The opening frame places the viewer above the lake with marina structures entering from the side. (0:00)
Aerial Westminster lake frame with more open green water, covered docks tucked along the left border, a small light speck on the water, sun reflection, and no visible people.
This second moment keeps the dock line at frame edge while the lake surface dominates the composition. (0:01)
Top-down lake view with covered docks near the upper left and a narrow shoreline strip.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.