Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Top View City Capacity Camera Panning Over Buildings

5s 4K UHD 29.97fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

This home movie captures a sweeping panning view over the urban landscape of Los Cabos, Mexico. The camera glides across modern buildings and cityscapes, offering a nostalgic glimpse of the vibrant coastal metropolis. This amateur footage showcases the area’s architectural density and scenic layout, perfect for travel, city life, or lifestyle content. The handheld perspective adds authentic charm, making it ideal for documentaries, editorial projects, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for travel edits, documentary context, agency mood reels, brand films, or social cuts that need an aerial view of Los Cabos urban development near the coast.
Edit role
The short runtime works as an opener, transition, or geographic cutaway between beach, fishing, and family moments in a Los Cabos sequence.

Tags

topviewcitycapacitycamerapanningbuildingsurbanmanicuristlandmarksLOS cabos mexico2019newbeautifulkindemotionhome movieamateurintroductionb-roll

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.265 (HEVC) MP4
File size
63 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
May 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over Los Cabos with cream apartment buildings, curving roads, dry hillside lots, green fields, and no visible people.
This opening frame gives buyers a clear overhead look at residential buildings and surrounding open land. (0:00)
High aerial view in Los Cabos showing apartment blocks beside a curved road, pale dirt paths, scattered houses, green turf, and no visible people.
This frame keeps the main apartment cluster centered while showing road access and the surrounding neighborhood texture. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.