Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Vehicle Walking Under Blue Sky With Vegetation On The Right

6s 4K UHD Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A 6-second home movie clip from Los Cabos, Mexico, in 2019, capturing a vehicle in motion on a sunny day. The scene features a bright blue sky, lush green vegetation along the right side of the frame, and a person walking nearby. Shot on amateur film, this cinematic b-roll footage evokes a modern, inspirational travel vibe with natural lighting and vibrant colors. Ideal for documentaries, travel content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for a travel edit, documentary road sequence, agency mood reel, brand film, or social cut needing forward-moving vehicle footage on a paved road in Los Cabos, Mexico.

Tags

greengrayblueyellowspeedvehiclewalkingskyvegetationleftsidetransportationLOS cabos mexico2019amateurintrocinematicmodernb-roll

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Los Cabos, Mexico
Year filmed
2019
Published
Dec 2019

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.