Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Vehicle Walking Under Blue Sky With Vegetation On The Right

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A 6-second home movie clip from Los Cabos, Mexico, in 2019, capturing a vehicle in motion on a sunny day. The scene features a bright blue sky, lush green vegetation along the right side of the frame, and a person walking nearby. Shot on amateur film, this cinematic b-roll footage evokes a modern, inspirational travel vibe with natural lighting and vibrant colors. Ideal for documentaries, travel content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for a travel edit, documentary road sequence, agency mood reel, brand film, or social cut needing forward-moving vehicle footage on a paved road in Los Cabos, Mexico.
Edit role
This short clip works as a road-trip opener, transition, or cutaway between destination beats, with enough visible roadway and scrub vegetation to bridge travel scenes without introducing a new character moment.
Visual details
The frames show a paved two-lane road under bright blue sky, green roadside vegetation, tall cacti, a yellow center line, pale road shoulders, and the black hood, windshield edge, mirror, and roof rack of a moving vehicle in the foreground.

Tags

greengrayblueyellowspeedvehiclewalkingskyvegetationleftsidetransportationLOS cabos mexico2019amateurintrocinematicmodernb-roll

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Dec 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Forward-facing vehicle view on a paved road in Los Cabos, Mexico, with the black hood and roof rack visible, green vegetation on both sides, cacti ahead, and no visible people.
The opening frame establishes the vehicle foreground and empty road under clear daylight. (0:00)
The vehicle continues along a straight paved road in Los Cabos, Mexico, with the roof rack crossing the right foreground, roadside brush filling the horizon, and no visible people.
This frame keeps the road centered while the vehicle hardware anchors the shot as travel POV footage. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.