Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Beautiful Scene of a Clean Empty Road With Green Grass

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A smooth, sunny drive through a quiet stretch of road in Los Cabos, Mexico,. The camera glides along a clean, empty road flanked by lush green grass and scattered trees under bright daylight. This vintage home movie footage offers a serene, cinematic view of modern transportation and natural beauty, evoking a sense of calm and freedom. Ideal for nostalgic or travel-themed projects.

Clip Intelligence

Production use
Useful for a Los Cabos travel edit, documentary road sequence, agency mood reel, brand film, or social cut needing a sunny empty-road drive through dry green roadside scrub.
Edit role
The short 8-frame run works as a transition, road-travel insert, or calm cutaway between destination scenes rather than a long establishing passage.
Visual details
A paved two-lane road curves through low green brush and sandy roadside banks, with a black vehicle roof bar and windshield edge in the foreground, blue sky and distant water on the horizon, and no visible people.

Tags

drivingsunnyweathercarroadgreengrasstreeblackvehicleautomotivebeautifulscenecleanemptytreesfrienddrivessmoothlytransportation

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Dec 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Front vehicle view on an empty Los Cabos road, with a black roof bar and windshield edge in the foreground, low green brush along both sides, distant water on the horizon, and no visible people.
The opening frame establishes the vehicle perspective on a quiet road through low coastal vegetation. (0:00)
Vehicle-mounted view continuing along a straight empty road in Los Cabos, with the black roof bar crossing the lower frame, scrub vegetation beside the pavement, blue sky, and no visible people.
This frame gives editors a clean forward-driving angle with clear pavement and roadside scrub. (0:01)
Empty road beginning to curve right with brush, sandy slopes, and vehicle bar in foreground.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.