Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Beautiful Scene of a Clean Empty Road With Green Grass

6s 4K UHD Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A smooth, sunny drive through a quiet stretch of road in Los Cabos, Mexico,. The camera glides along a clean, empty road flanked by lush green grass and scattered trees under bright daylight. This vintage home movie footage offers a serene, cinematic view of modern transportation and natural beauty, evoking a sense of calm and freedom. Ideal for nostalgic or travel-themed projects.

Clip Intelligence

Production use
Useful for a Los Cabos travel edit, documentary road sequence, agency mood reel, brand film, or social cut needing a sunny empty-road drive through dry green roadside scrub.

Tags

drivingsunnyweathercarroadgreengrasstreeblackvehicleautomotivebeautifulscenecleanemptytreesfrienddrivessmoothlytransportation

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Los Cabos, Mexico
Year filmed
2019
Published
Dec 2019

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Front vehicle view on an empty Los Cabos road, with a black roof bar and windshield edge in the foreground, low green brush along both sides, distant water on the horizon, and no visible people.
The opening frame establishes the vehicle perspective on a quiet road through low coastal vegetation. (0:00)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.