Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

View Of A Small White Spider On A White Surface (2014)

6s 4K UHD 29.97fps Wildlife 2014
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A close-up view of a small white spider on a plain white surface, captured in a home movie style. The minimalist composition highlights the delicate structure of the spider against the stark background, creating an abstract and visually striking moment. Shot in 2014 as amateur digital footage, this clip offers a unique perspective on tiny wildlife, blending natural detail with artistic simplicity. Ideal for creative projects exploring texture, contrast, or the overlooked beauty of insects.

Clip Intelligence

Production use
Documentary editors, science producers, agency mood reels, and social cuts can use this 4K close-up of a small pale spider on a white surface for micro-wildlife, texture, or abstract nature moments.
Edit role
Use it as a short insert, cutaway, or visual texture beat within a wildlife, home-science, or abstract sequence where a brief macro detail needs to interrupt a broader scene.
Visual details
A tiny pale spider fills the soft-focus frame on a cream-white surface, with translucent legs, faint dark leg tips, shallow depth of field, warm indoor light, and no visible people.
Shot mechanics
The clip uses a very close ground-level macro composition with the spider held near center-right, a blurred white background, and limited visible change between sampled frames.

Tags

white spiderwhitesurfacesmalltineinsectviewspideranimalswildlifehome moviestock video4kstunningabstract

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
43 MB
Year filmed
2014
Published
Dec 2014

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Small pale spider seen in soft focus on a cream-white surface at the start of the clip, with translucent legs and no visible people.
The opening frame presents the spider as a minimal macro wildlife detail against a plain white background. (0:00)
Pale spider remains near the center-right of a plain light surface, with its legs spread and the background falling out of focus, no visible people.
This frame gives editors a clean view of the spider's body and thin legs for a nature insert. (0:01)
Close macro view of the small white spider on the pale surface, with a faint yellow object blurred at left and no visible people.
The frame keeps the spider isolated while a soft yellow blur adds slight depth to the otherwise minimal scene. (0:02)
Tiny spider on cream-white background

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.