Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: View From A Vehicle Traveling Rapidly On A Paved Street

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

This clip captures a first-person view from a vehicle speeding along a paved road in Los Cabos, Mexico. Palm trees line the roadside, flanking the journey through a sun-drenched desert landscape. The rapid motion and natural scenery evoke a sense of adventure and freedom, offering a nostalgic glimpse of modern travel in a tropical setting. This home movie footage is ideal for documentaries, travel content, or editorial projects exploring contemporary road trips and scenic destinations.

Clip Intelligence

Production use
Useful for travel edits, documentary sequences, agency mood reels, brand films, or social cuts needing a moving road-view through Los Cabos with palms, paved streets, walls, and dry roadside lots.
Edit role
The short runtime works as a quick transition, road-travel insert, location texture beat, or connective cutaway between beach, resort, fishing, and family moments in a Los Cabos sequence.

Tags

carroaddesertpalm treesoutdoorsstreetviewvehicletravelingrapidlypavedflankedpalmtreesnatureLOS cabos mexico2019artbuyfootage

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide road view in Los Cabos with a paved street, curbside grass, tall palms, a fenced dry lot, and no clearly visible people in the foreground.
The opening frame gives a forward road-view with palms and dry roadside land for a Los Cabos travel insert. (0:00)
Forward-facing Los Cabos street view with asphalt, curbside grass, palms on both sides, low walls, dry lots, and no visible people.
This frame shows the clip's clean road perspective with palms, walls, and bright midday light. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.