Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: A Red Vehicle Travels Down A Road Flanked By Palm Trees

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A red vehicle travels down a sunlit road flanked by tall palm trees in Los Cabos, Mexico,. The scene evokes a tropical vacation vibe with lush greenery and bright daylight, showcasing a classic road trip moment from a vintage perspective. This authentic home movie footage offers a nostalgic glimpse into modern travel and leisure in a popular Mexican destination, perfect for storytelling, travel content, or retro-themed projects.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this Los Cabos road clip to show resort-area transit without crowds or visible people.
Edit role
The short six-second view works as a cutaway, transition, or route insert between fishing, beach, hotel arrival, or family travel moments in a Los Cabos sequence.
Visual details
A red pickup travels along a sunlit paved road bordered by curbs, grass strips, tall palms, desert planting, low hills, and blue sky, with no visible people in the frames.

Tags

truckroadstreettreesdaytimepalmredvehicletravelsflankedtransportationLOS cabos mexico2019kindprointroductioninspirationb-rollromance

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A red pickup drives along a broad paved road in Los Cabos, Mexico, beside curbs, palms, desert plants, and low hills, with no visible people.
This opening frame shows the red vehicle entering a palm-lined road setting in bright daylight. (0:00)
The red pickup continues along the curved Los Cabos road with palms, landscaped islands, pale pavement, and low green hills in the background, with no visible people.
This frame keeps the vehicle centered ahead while the road curves through palms and planted medians. (0:01)
Red pickup near the right curb on a palm-lined intersection.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.