Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Little Girl Hitting A Pinata As Her Family Watches

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A young girl in a colorful dress swings a bat at a pinata during a lively celebration in Los Cabos, Mexico, 2019. Her family watches with smiles and laughter, capturing a joyful moment of childhood fun. This home movie footage captures the vibrant energy of a festive gathering with natural lighting and candid emotion. The scene reflects authentic family bonding and cultural celebration, perfect for nostalgic or lifestyle content.

Clip Intelligence

Production use
Useful for travel edits, family documentary scenes, agency mood reels, brand films, and social cuts needing a candid 2019 Los Cabos birthday or vacation celebration with children and adults visible.
Edit role
Works as a short insert or reaction beat in a family travel sequence, showing the swing at the pinata and the watching group before cutting to other vacation or celebration footage.
Visual details
A young girl in a bright pink swimsuit swings a striped stick at a colorful hanging pinata while children and adults watch on a grassy patio with red umbrellas, a thatched roof, palm trunk, chairs, and soft daylight.

Tags

girltoypinatafunplayhittingfamilywatcheskidspeopleLOS cabos mexico2019inspirationhome movieamateurnewmoderncurrent

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
77 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

In Los Cabos, Mexico, children and adults stand on a grassy patio under red umbrellas as a colorful pinata hangs near a palm trunk at the start of the clip.
This opening frame establishes the family group waiting around the pinata before the swing. (0:00)
In Los Cabos, Mexico, a girl in pink moves toward the hanging pinata as other children and adults watch from the patio near umbrellas and a thatched shelter.
This frame shows the child approaching the pinata while the family forms a loose viewing circle. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.