Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Man With Glasses Driving A Vehicle Down A Very Dark Road

6s 4K UHD Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A man wearing glasses drives a vehicle down a dark, isolated road in Los Cabos, Mexico,. The low-light footage creates a moody, atmospheric scene with deep shadows and a sense of mystery. The handheld perspective and grainy texture evoke a raw, authentic feel typical of amateur home movies from the era. This clip offers a cinematic, noir-inspired moment ideal for storytelling, suspense, or atmospheric background footage.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, or suspense sequence needing a night drive on a dark road in Los Cabos, Mexico, with a visible driver in silhouette.

Tags

darknessroadblackmalecreepymanglassesdrivingvehicledarknighttransportationLOS cabos mexico2019buyintroamateurabstractprofessionalstock video

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Dark road ahead from inside a vehicle with a driver silhouette.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.