Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Man With Glasses Driving A Vehicle Down A Very Dark Road

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A man wearing glasses drives a vehicle down a dark, isolated road in Los Cabos, Mexico,. The low-light footage creates a moody, atmospheric scene with deep shadows and a sense of mystery. The handheld perspective and grainy texture evoke a raw, authentic feel typical of amateur home movies from the era. This clip offers a cinematic, noir-inspired moment ideal for storytelling, suspense, or atmospheric background footage.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, or suspense sequence needing a night drive on a dark road in Los Cabos, Mexico, with a visible driver in silhouette.
Edit role
The short six-second clip works as a moody insert, transition, or tension beat between daytime Los Cabos scenes and a night travel or road sequence.
Visual details
A man wearing glasses is seen in dark silhouette inside a vehicle, with headlights lighting a narrow road, roadside barriers, and small distant lights against a mostly black background.

Tags

darknessroadblackmalecreepymanglassesdrivingvehicledarknighttransportationLOS cabos mexico2019buyintroamateurabstractprofessionalstock video

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At the start of the Los Cabos, Mexico clip, a silhouetted driver is seen at right while headlights reveal a dark road and low roadside barriers.
The opening frame establishes the interior driving viewpoint and the road lit only by vehicle headlights. (0:00)
One second into the Los Cabos, Mexico drive, the driver's dark profile remains at right as the headlights reach farther down the empty road.
This frame shows the driver held in silhouette while the road ahead stays mostly unlit. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.