Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Wrangler Mount Recording Of Tractor Driving Through Rural Night

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A 6-second home movie clip from 2019, captured in Los Cabos, Mexico, showing a tractor driving through a dark, grassy rural landscape at night. Headlights cut through the darkness as the vehicle moves along a dirt road, surrounded by shrubs and open fields. The handheld recording has a raw, cinematic quality, evoking a sense of quiet isolation and nocturnal adventure. This authentic home movie footage offers a rare glimpse into rural life and transportation in a remote Mexican setting, perfect for documentaries, editorial content, or nostalgic storytelling.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, or social cut needing a night drive through rural Los Cabos with headlights crossing brush and a dirt road.
Edit role
The short runtime works as a nocturnal transition, suspense beat, or insert between daytime Los Cabos scenes and a remote rural travel sequence.
Visual details
Headlights illuminate a sandy dirt track, scrubby bushes, dry grass, a dark blue night sky, and the black interior outline of the vehicle with a non-recognizable seated silhouette in front.

Tags

ruralfarmnighteveningdarkheadlightsscarynocturnalwranglermountrecordingtractordrivinggrassyroadshrubstransportationLOS cabos mexico2019art

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Vehicle-mounted night view in Los Cabos, Mexico, with headlights lighting a sandy dirt road, dense brush on both sides, and a dark non-recognizable seated silhouette in the foreground.
The opening frame sets up the vehicle-mounted view as the headlights carve into the rural road ahead. (0:00)
Night road frame from Los Cabos, Mexico, with the vehicle interior silhouetted at right and the headlight beam centered on pale dirt and green roadside shrubs.
This moment shows the road and brush held in the narrow pool of headlight light. (0:01)
Headlights sweep across a dirt road bordered by brush in darkness.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.