Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Jeep Two Mensa Traveling In Desert Night Travel Front

6s 4K UHD Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A vintage clip from 2019 captures two men traveling in a jeep through the desert at night in Los Cabos, Mexico. The vehicle’s headlights cut through the darkness, illuminating the sandy terrain and sparse trees under a starry sky. The raw, grainy footage evokes a sense of adventure and solitude, showcasing a rugged journey through the arid landscape. This authentic home movie style footage offers a nostalgic glimpse into a nocturnal desert expedition.

Clip Intelligence

Production use
Fits a travel edit, documentary night-driving sequence, agency mood reel, brand film, or social cut needing a raw passenger-view jeep ride through desert terrain in Los Cabos, Mexico.

Tags

jeepmentravelingdesertnighttravelfrontlightdrivingskytreesmensatransportationLOS cabos mexico2019businesscurrentstunningprettyb-roll

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.