Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Wrangler Passes Parked Vehicle On Sunny Day

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A modern Wrangler drives past a parked vehicle on a bright, sunny day in Los Cabos, Mexico, captured in 2019. This home movie footage showcases a calm, everyday moment with natural sunlight and a relaxed atmosphere. The scene reflects a casual, authentic slice of life in a contemporary Mexican coastal setting. Ideal for travel, lifestyle, or transportation-themed content.

Clip Intelligence

Production use
Useful for a travel edit, documentary insert, agency mood reel, brand film, or social cut needing everyday road traffic in Los Cabos, Mexico with a Wrangler foreground and passing cars in hard sun.
Edit role
The short runtime works as a quick transportation cutaway or transition beat between beach, fishing, and street-life moments in a Los Cabos sequence.
Visual details
A Wrangler roll bar, roof, steering wheel, and black seat fill the foreground while a gray sedan passes a parked vehicle near a small yellow roadside building under bright blue sky, with no visible people.

Tags

cardriversunhotcalmwranglerpassesparkedvehiclesunnydaytransportationLOS cabos mexico2019modernhome videohome movieamateurprofessionalvideography

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At the start of the Los Cabos clip, a gray sedan sits near the left edge while the Wrangler seat, roll bar, and roof frame the right side, with no visible people.
The opening frame establishes the Wrangler foreground and a passing car on a bright roadside. (0:00)
One second in, the gray sedan is farther across the dusty Los Cabos road while the Wrangler seat and black roof dominate the foreground, with no visible people.
This frame shows the passing sedan clearing more of the Wrangler-framed roadside view. (0:01)
Rear of gray sedan passing a parked vehicle near a yellow building.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.