Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Empty Wrangler and Quiet Road with Trees

6s 4K UHD 59.96fps Los Cabos, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Shot in 2019 in Los Cabos, Mexico, this home movie clip captures a quiet, empty scene featuring a Wrangler parked near a building with trees in the background. The footage shows a still, contemplative moment on a quiet road, with no people present. The setting evokes a sense of solitude and calm, showcasing the natural beauty and modern architecture of the region. This vintage-style home movie offers a nostalgic glimpse into a serene moment in a popular Mexican destination.

Clip Intelligence

Production use
Useful for travel edits, documentary cutaways, agency mood reels, or social cuts needing a quiet Los Cabos roadside moment with a parked open vehicle, dusty road, small buildings, and trees.
Edit role
This short clip works as a transitional cutaway or observational insert between busier fishing, beach, or arrival scenes in a Los Cabos sequence.
Visual details
The view looks past a black open vehicle seat and roll frame toward a dusty road, a parked silver SUV, a white vehicle, a yellow storefront, utility poles, scrubby trees, strong sun, and a small visible person near the building.

Tags

cartreesroadsbuildingvehiclesemptywranglerniceseatbuildingslandmarksLOS cabos mexico2019professionalstunningabstractstock video4k

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Nov 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

In Los Cabos, Mexico, the first frame looks past a black open vehicle seat toward a dusty roadside, a silver SUV, a yellow storefront, utility poles, trees, and a small person near the building.
The opening moment sets up the clip from inside or beside an open vehicle facing a quiet roadside scene. (0:00)
At 0:01 in Los Cabos, Mexico, the black seat and roll bar dominate the foreground while the dusty road, parked vehicles, yellow building, trees, and a small person remain in the background.
This frame keeps the vehicle interior as the main foreground detail while preserving the roadside context behind it. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.